.

.

Rekombinant İnsan CAAX prenil proteaz 1 homolog (ZMPSTE24) (Rekombinant Protein)

Rekombinant İnsan CAAX prenil proteaz 1 homolog (ZMPSTE24) (Rekombinant Protein)

₺ 177.00

İşlenmemiş
mevcut

Genadı : ZMPSTE24; HGPS; PRO1; YÜZ1; STE24; YÜZ-1; Ste24p; YÜZ1, STE24. Eşanlamlı : Rekombinant CAAX prenil proteaz 1 homolog (ZMPSTE24).CAAX prenil proteaz 1 homolog EC = 3.4.24.84; Farnesile proteinler dönüştürücü enzim 1. YÜZ-1 Prenil proteine özgü endoproteaz 1 Çinko metaloproteinaz Ste24 homolog.CAAX prenil proteaz 1 homologu; çinko metalopeptidaz STE24 homologu.Kaynak : E Coli veya Maya.Saflık : > %90 ;* Etiket Bilgisi : Etiketlendi; * Türler : Homo sapiens (İnsan).Depolama Tamponu : PBS p H 7.4, %50 gliserol; * Seq Pos : 1-475. Depolama : -20 derece C'de saklayın. Genişletilmiş depolama için -20 veya -80 derece C'de saklayın.Bu öğe için ÜCRETSİZ-8 GB-USBDrive.Madde araştırma kullanım içindir.Teşhis / tedavi prosedürü için değil. * Form : Bu ürün özel üretim gerektirir ve teslim süresi 5-9 hafta arasındadır.Spesifikasyonlarınıza göre özel üretim yapabiliriz. NP_005848 ; *Seq : MGMWASLDALWEMPAEKRİFGAVLLFSWTVYLWETFLAQRQRRİYKTTTHVPPELGQİMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLİLLFGGİPYLWRLSGRFCGYAGFGPEYEİTQSLVFLLLATLFSALTGLPWSLYNTFVİEEKHGFNQQTLGFFMKDAİKKFVVTQCİLLPVSSLLLYİİKİGGDYFFİYAWLFTLVVSLVLVTİYADYİAPLFDKFTPLPEGKLKEEİEVMAKSİDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRİVLFDTLLEEYSVLNKDİQEDSGMEPRNEEEGNSEEİKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNİİİSQMNSFLCFFLFAVLİGRKELFAAFGFYDSQPTLİGLLİİFQFİFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALİKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH; *Katılım* : .2; NM_005857.4; O75844; *NCBI Özet : Bu gen peptidaz M48 A ailesinin bir üyesini kodlar.Kodlanmış protein, olgun lamin A oluşturmak üzere farnesile edilmiş prelamin A'nın karboksi terminal kalıntılarının iki aşamalı translasyon sonrası proteolitik bölünmesinde rol oynayan bir çinko metaloproteinazdır.Bu gendeki mutasyonlar mandibuloakral displazi ve restriktif dermopati ile ilişkilendirilmiştir. [Ref Seq, Temmuz 2008 tarafından sağlanmıştır]; * Uniprot Özeti : Fonksiyon : Farnesile edilmiş proteinlerin C-terminal üç kalıntısını proteolitik olarak uzaklaştırır.Katalitik aktivite : Hidrolize edilmiş peptit bağı, C'nin bir S-izoprenile sistein kalıntısı olduğu, A'nın genellikle alifatik olduğu ve X'in substrat proteininin C-terminal kalıntısı olduğu-C-|-A-A-X olarak tanımlanabilir ve birkaç taneden herhangi biri olabilir. amino asitler.Kofaktör : Alt birim başına 1 çinko iyonunu benzerlik ile bağlar.Hücre altı yeri : Endoplazmik retikulum membranı; Çok geçişli membran proteini.Golgi aparatı membranı; Çok geçişli membran proteini Muhtemel.Doku özgüllüğü : Yaygın olarak ifade edilir.Böbrek, prostat, testis ve yumurtalıklarda yüksek seviyeler.Hastalığa katılım : zmpste24'teki defektler tip B lipodistrofili (MADB) mandibuloakral displazinin nedenidir [MIM : 608612].Mandibuloakral displazi (MAD), mandibular ve klaviküler hipoplazi, akroosteol ile karakterize nadir görülen otozomal resesif bir hastalıktır.

Detaylar

Benzer ürünler kategorisinde